Skip to Content

Recombinant Human Protein flightless-1 homolog (FLII), partial, E.coli expression - 2 mg

https://www.gen.bg/web/image/product.template/19581/image_1920?unique=325b45d
(0 review)

Uniprot: Q13045
Expression Region: 495-827aa (partial)
Tag: N-terminal 10xHis-tag and C-terminal Myc-tag

0.00 лв 0.0 BGN 0.00 лв Tax Excluded

For price contact info@gentaur.com

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Uniprot: Q13045

    Expression Region: 495-827aa (partial)

    Tag: N-terminal 10xHis-tag and C-terminal Myc-tag

    Target Protein Sequence:

    VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAAAEQKLISEEDL