Skip to Content
  • Low Price Guarantee 30 Days Online Returns Standard Shipping
  • Contact Us
Гентауър България
  • 0
    My Cart
  • Sign in
  • Продукти
  • Правила и условия
  • Home
  • Shop
  • Events
  • Blog
  • Appointment
  • Contact us
Гентауър България
  • 0
    • Продукти
    • Правила и условия
    • Home
    • Shop
    • Events
    • Blog
    • Appointment
    • Contact us
  • Low Price Guarantee 30 Days Online Returns Standard Shipping
  • Sign in
  • Contact Us
  1. All products
  2. ATP2A2 (SERCA2) Polyclonal Antibody - 100 uL
  3. All products
Pricelist: Price List Default - EUR Pricelist
Price List Default - EUR
Pricelist: Price List Default - EUR Pricelist
Price List Default - EUR
ATP2A2 (SERCA2) Polyclonal Antibody - 100 uL

ATP2A2 (SERCA2) Polyclonal Antibody - 100 uL

(0 review)
0.00 лв 0.00 лв (Tax excluded)

Add to cart
Buy now
Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days
Contact Us

Uniprot No.: P16615


Target Name: ATP2A2


Alternative Names: AT2A2_HUMAN antibody; Atp2a2 antibody; ATP2B antibody; ATPase Ca++ transporting cardiac muscle slow twitch 2 antibody; Calcium pump 2 antibody; Calcium-transporting ATPase sarcoplasmic reticulum type antibody; Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform antibody; Cardiac Ca2+ ATPase antibody; DAR antibody; DD antibody; Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody; MGC45367 antibody;  Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 antibody; SERCA 2 antibody; SERCA2 antibody; serca2a antibody; slow twitch skeletal muscle isoform antibody


Raised in: Rabbit


Species Reactivity: Human, Mouse, Rat


Immunogen: Synthesized peptide derived from the C-terminal region of Human SERCA2.


Immunogen sequence: CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIF


Immunogen Species: Homo sapiens (Human)


Conjugate: Non-conjugated


Isotype: IgG


Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.


Concentration: usually 1mg/ml (Batch dependent)


Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.


Form: Liquid


Tested Applications: WB, ELISA

WB: 1:500-1:2000

ELISA: 1:20000


Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.


PDF datasheet: 

Customer Reviews

Гентауър България

Лабораторно снабдяване
Изследователски, диагностични и ветеринарни лаборатории

Гентауър ЕООД
Ул. Искър 53
1191 Кокаляне,
София
Phone +35924682280
Fax +35929830070

  • +359 24 68 22 80
  • info@gentaur.com
Follow us
Авторско право © Гентауър ЕООД
Powered by Odoo - The #1 Open Source eCommerce