Хypothetical protein WP_003477458 459bp pUC vector - 100ug plasmid + 200ul glycerol

https://www.gentaur.be/web/image/product.template/5440/image_1920?unique=8f28d63
(0 review)

813,40 лв 813.4 BGN 813,40 лв VAT Excluded

415,00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    DNA Sequence:

    RC48GOI: atgagtccatattatagatataaaaaagaaaaatttttagaaaagtatcaatcagcaactgataacttagaagatttaaaagtagcaataaaagaatataaagatactaataatagaattataagaagagctatgtttgctttctttcaagatttcactgaatatattattgatatgtgtgaaagttatatattgataaatgatgggaaaataaagagtacaacttctgcaacacagctagttgaacaagcatatgatatgggcttttttgataatgaactaaaaaaatacttagttttatcagtgaaacttagaaatagatatactcatgattattacctaagagaagagagcgaaaaagcaatagaagaattctgttttttaaaactagcaaatctagaaatatttttagaagaaagtaaggataaagttattcttaaatataaaaatttagtttaaMSPYYRYKKE

    Protein sequence:

    KFLEKYQSATDNLEDLKVAIKEYKDTNNRIIRRAMFAFFQDFTEYIIDMC
    ESYILINDGKIKSTTSATQLVEQAYDMGFFDNELKKYLVLSVKLRNRYTHDYYLREESEKAIEEFCFLKLANLEIFLEESKDKVILKYKNLV