Преминете към съдържание
  • Low Price Guarantee 30 Days Online Returns Standard Shipping
  • Свържете се с нас
Гентауър България
  • 0
    Моята количка
  • Вход
  • Продукти
  • Правила и условия
  • Начало
  • Shop
  • Събития
  • Blog
  • Appointment
  • Свържете се с нас
Гентауър България
  • 0
    • Продукти
    • Правила и условия
    • Начало
    • Shop
    • Събития
    • Blog
    • Appointment
    • Свържете се с нас
  • Low Price Guarantee 30 Days Online Returns Standard Shipping
  • Вход
  • Свържете се с нас
  1. All products
  2. E. coli Recombinant proteins
  3. gene-34085.1 Recombinant Protein expressed in E.coli - 1 mg
  4. E. coli Recombinant proteins
Ценова листа: Price List Default - EUR Ценова листа
Price List Default - EUR
Ценова листа: Price List Default - EUR Ценова листа
Price List Default - EUR
gene-34085.1 Recombinant Protein expressed in E.coli - 1 mg

gene-34085.1 Recombinant Protein expressed in E.coli - 1 mg

(0 review)
0,00 лв 0,00 лв (Tax excluded)

Add to cart
Купи сега
Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days
Свържете се с нас

Expression System: E. coli

Expression Region: Expression Region: 1-133aa;Full Length

Tag Information: N-terminal His Tag


Target Protein Sequence

Target Protein Sequence
(The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHD

GSVWAQSSNFPQFKAEEISDIMKDFEEPGHLAP

TGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTVK

KTSQALVFGIYEEPVTPGQCNMVVERLGDYLVD

QGL

Customer Reviews

Гентауър България

Лабораторно снабдяване
Изследователски, диагностични и ветеринарни лаборатории

Гентауър ЕООД
Ул. Искър 53
1191 Кокаляне,
София
Phone +35924682280
Fax +35929830070

  • +359 24 68 22 80
  • info@gentaur.com
Последвайте ни
Авторско право © Гентауър ЕООД
Powered by Odoo - The #1 Отворен източник - електронна търговия