gene-16748.1 Recombinant Protein expressed in E.coli - 1 mg

https://www.gentaur.be/web/image/product.template/9550/image_1920?unique=fbf3e39
(0 review)

2963,52 лв 2963.52 BGN 2963,52 лв VAT Excluded

1512,00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Expression System: E. coli

    Expression Region: Expression Region: 1-179aa;Full Length

    Tag Information: N-terminal His Tag


    Target Protein Sequence

    (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):

    MATNSAPLNSSSSQIKSSPSPSSLSIQNTEEVEKV

    FNRFDTNGDGKISVTELGAVFSSLGSSFSDEDEL

    RRIMDELDSDHDGFISLTEFAAFCSSSSAEDGGA

    SELRDAFKLYDQDQNGLISASELHLVLNRLGMN

    CSVEDCHRMIRSVDSDGDGNVNFEEFQKMMT

    TANANNSKASPL