Преминете към съдържание

PEGFP- NOTCH1- NICD- R 2ug

https://www.gen.bg/web/image/product.template/3948/image_1920?unique=26bf337
(0 review)

0,00 лв 0.0 BGN 0,00 лв Tax Excluded

For Price Contact: info@gentaur.com

    This combination does not exist.

    Общи условия
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    pEGFP-Notch1-NICD-r


    Catalog No. PVT10478
    Packing 2ug
     

    pEGFP-Notch1-NICD-r Information

    Promoter: CMV promoter

    Replicator: pUC ori, F1 ori, SV40 ori

    Terminator: SV40 poly (A) signal

    Plasmid classification: gene library plasmid; rat gene plasmid; rat eukaryotic plasmid.

    Plasmid size: 7079bp

    Plasmid tagging: C-EGFP

    Prokaryotic resistance: Kan (50 g/ml)

    Selection marker: Neo/G418

    Cloning strains: E. coli DH5 and E.

    Culture conditions: 37 C, LB, aerobic.

    Expression host: mammalian cells such as 293T

    Culture conditions: 5%CO2, 37 C

    Induction mode: no need to induce

    5'sequencing primers: pEGFP-N-5 (TGGGAGGTCTATATAAGCAGAG)

    3'sequencing primers: pEGFP-N-3 (CGTCGCCGTCCAGCTCGACCAG)

     

    pEGFP-Notch1-NICD-r Description
    pEGFP-Notch1-NICD-r expresses EGFP-Notch1-NICD fusion protein under the action of CMV strong promoter. The transmembrane macromolecule Notch1 receptor is mainly involved in the selection of cell fate during development. The active fragment-cytoplasmic domain (NICD) of G1743 and V1744 can be transported into the nucleus and activate the expression of target genes. Notch1 plays an important role in cell proliferation, differentiation, programmed death, morphogenesis and organogenesis during development. Cheng. Our constructed pEGFP-Notch1-NICD-r plasmid was transfected into COS-7L cells and green fluorescent protein was observed as nuclear localization, suggesting that the cloned NICD gene is in line with the further study of the function of NICD in post-division neurons.

     

    pEGFP-Notch1-NICD-r  Multiple cloning site

     

    pEGFP-Notch1-NICD-r Sequence

    LOCUS       Exported                7097 bp ds-DNA     circular SYN 04-JUL-2017
    DEFINITION  synthetic circular DNA
    ACCESSION   .
    VERSION     .
    KEYWORDS    pEGFP-Notch1-NICD-r
    SOURCE      synthetic DNA construct
      ORGANISM  synthetic DNA construct
    REFERENCE   1  (bases 1 to 7097)
      AUTHORS   yinchu
      TITLE     Direct Submission
      JOURNAL   Exported Tuesday, July 4, 2017 from SnapGene Viewer 3.3.4
                http://www.snapgene.com
    FEATURES             Location/Qualifiers
         source          1..7097
                         /organism="synthetic DNA construct"
                         /mol_type="other DNA"
         enhancer        61..364
                         /label=CMV enhancer
                         /note="human cytomegalovirus immediate early enhancer"
         promoter        365..568
                         /label=CMV promoter
                         /note="human cytomegalovirus (CMV) immediate early
                         promoter"
         misc_feature    637..3002
                         /label=Notch1-NICD-r
                         /note="Rattus norvegicus notch 1 (Notch1), mRNA
                        
                         NCBI Reference Sequence: NM_001105721.1
                        
                         "
         CDS             3043..3762
                         /codon_start=1
                         /product="enhanced GFP"
                         /label=EGFP
                         /note="mammalian codon-optimized"
                         /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                         KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                         GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                         VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                         EFVTAAGITLGMDELYK"
         polyA_signal    3885..4006
                         /label=SV40 poly(A) signal
                         /note="SV40 polyadenylation signal"
         rep_origin      complement(4013..4468)
                         /direction=LEFT
                         /label=f1 ori
                         /note="f1 bacteriophage origin of replication; arrow
                         indicates direction of (+) strand synthesis"
         promoter        4495..4599
                         /gene="bla"
                         /label=AmpR promoter
         promoter        4601..4958
                         /label=SV40 promoter
                         /note="SV40 enhancer and early promoter"
         rep_origin      4809..4944
                         /label=SV40 ori
                         /note="SV40 origin of replication"
         CDS             4993..5787
                         /codon_start=1
                         /gene="aph(3')-II (or nptII)"
                         /product="aminoglycoside phosphotransferase from Tn5"
                         /label=NeoR/KanR
                         /note="confers resistance to neomycin, kanamycin, and G418
                         (Geneticin(R))"
                         /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                         VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                         SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                         GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                         LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
         polyA_signal    6019..6066
                         /label=HSV TK poly(A) signal
                         /note="herpes simplex virus thymidine kinase
                         polyadenylation signal (Cole and Stacy, 1985)"
         rep_origin      6395..6983
                         /direction=RIGHT
                         /label=ori
                         /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                         replication"
    ORIGIN
            1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg
           61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt
          121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca
          181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc
          241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta
          301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac
          361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg
          421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg
          481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt
          541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta
          601 ccggactcag atctcgagct caagcttcga attctgatgc tgctgtcccg caagcgcagg
          661 cggcagcatg gccagctctg gttccctgag ggtttcaaag tgtcagaggc cagcaagaag
          721 aagcggagag aacccctcgg cgaggactca gtcggcctca agcccctgaa gaacgcctca
          781 gatggtgccc tgatggacga caatcagaac gagtgggggg acgaagacct ggagaccaag
          841 aagttccggt ttgaggaacc agtggttctc cctgacctgg atgatcagac tgaccaccgg
          901 cagtggaccc agcagcacct ggatgccgct gacctacgtg tgtctgccat ggccccaacg
          961 ccgcctcagg gggaggtaga tgctgactgc atggacgtca atgttcgagg accagatggc
         1021 ttcactcccc taatgattgc ctcctgcagc ggagggggcc tggagacagg caacagtgag
         1081 gaagaagaag atgcacctgc tgtcatctcc gacttcatct atcagggtgc cagcttgcac
         1141 aaccagacgg accgcacagg ggagactgcc ctgcacctgg ctgcccgata ctctcgttca
         1201 gatgctgcca agcgcttgct ggaggccagc gcagatgcca acatccaaga caacatgggg
         1261 cgtaccccat tacatgccgc tgtttctgca gacgctcagg gtgtcttcca gatcctgctc
         1321 cggaacagag ccacagatct ggatgcccga atgcatgatg gcacaacccc tctgatcctg
         1381 gcggcacgcc tggccgtgga aggcatgcta gaggacctca tcaactctca cgctgatgtc
         1441 aatgctgtgg atgacctagg caagtcagct ctgcactggg cagccgctgt gaacaatgtg
         1501 gacgctgctg ttgtgctcct gaagaacgga gccaacaaag acatgcagaa caacaaggag