PCDNA3.1 EYFP H148Q- I152L, 2 ug

https://www.gentaur.be/web/image/product.template/1847/image_1920?unique=7dfc6f1
(0 review)

789,88 лв 789.88 BGN 789,88 лв VAT Excluded

403,00 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    pCDNA3.1 EYFP H148Q-I152L


    Catalog No. PVT10772
    Packing 2ug

     

    pCDNA3.1 EYFP H148Q-I152L Information

    Promoter: CMV

    Replicator: pUC

    Growth Strain: DH5a

    Culture temperature: 37℃

    Host: Mammalian cells

    Plasmid uses: Protein expression

    Segment type: ORF

    Fragment species:

    Prokaryotic resistance: Amp

    Selectable markers: Neo/G418

    Fluorescent marking: yellow

     

    pCDNA3.1 EYFP H148Q-I152L Desccription
    pCDNA3.1 EYFP H148Q-I152L is a  Mammalian fluorescent plasmid.

     

    pCDNA3.1 EYFP H148Q-I152L Sequence

    LOCUS Exported 6178 bp ds-DNA circular SYN 27-SEP-2017

    DEFINITION synthetic circular DNA

    ACCESSION .

    VERSION .

    KEYWORDS .

    SOURCE synthetic DNA construct

    ORGANISM synthetic DNA construct

    REFERENCE 1 (bases 1 to 6178)

    AUTHORS .

    TITLE Direct Submission

    JOURNAL Exported Sep 27, 2017

    FEATURES Location/Qualifiers

    source 1..6178

    /organism="synthetic DNA construct"

    /mol_type="other DNA"

    enhancer 202..581

    /label=CMV enhancer

    /note="human cytomegalovirus immediate early enhancer"

    promoter 582..785

    /label=CMV promoter

    /note="human cytomegalovirus (CMV) immediate early

    promoter"

    promoter 830..848

    /label=T7 promoter

    /note="promoter for bacteriophage T7 RNA polymerase"

    regulatory 927..936

    /regulatory_class="other"

    /note="vertebrate consensus sequence for strong initiation

    of translation (Kozak, 1987)"

    CDS 933..1652

    /codon_start=1

    /product="enhanced YFP"

    /label=EYFP

    /note="mammalian codon-optimized"

    /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

    KFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

    GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSQNVYLMADKQKNGIK

    VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL

    EFVTAAGITLGMDELYK"

    polyA_signal 1745..1969

    /label=bGH poly(A) signal

    /note="bovine growth hormone polyadenylation signal"

    rep_origin 2015..2443

    /direction=RIGHT

    /label=f1 ori

    /note="f1 bacteriophage origin of replication; arrow

    indicates direction of (+) strand synthesis"

    promoter 2457..2786

    /label=SV40 promoter

    /note="SV40 enhancer and early promoter"

    rep_origin 2637..2772

    /label=SV40 ori

    /note="SV40 origin of replication"

    CDS 2853..3647

    /codon_start=1

    /gene="aph(3')-II (or nptII)"

    /product="aminoglycoside phosphotransferase from Tn5"

    /label=Neo

    /note="confers resistance to neomycin, kanamycin, and G418

    (Geneticin(R))"

    /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

    VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

    SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

    GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

    LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

    polyA_signal 3821..3942

    /label=SV40 poly(A) signal

    /note="SV40 polyadenylation signal"

    rep_origin complement(4393..4978)

    /direction=LEFT

    /label=ori

    /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of

    replication"

    CDS complement(5149..6009)

    /codon_start=1

    /gene="bla"

    /product="beta-lactamase"

    /label=AmpR

    /note="confers resistance to ampicillin, carbenicillin, and

    related antibiotics"

    /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

    ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

    PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

    EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

    LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

    LIKHW"

    promoter complement(6010..6114)

    /gene="bla"

    /label=AmpR promoter

    ORIGIN

    1 gcactctcag tacaatctgc tctgatgccg catagttaag ccagtatctg ctccctgctt

    61 gtgtgttgga ggtcgctgag tagtgcgcga gcaaaattta agctacaaca aggcaaggct

    121 tgaccgacaa ttgcatgaag aatctgctta gggttaggcg ttttgcgctg cttcgcgatg

    181 tacgggccag atatacgcgt tgacattgat tattgactag ttattaatag taatcaatta

    241 cggggtcatt agttcatagc ccatatatgg agttccgcgt tacataactt acggtaaatg

    301 gcccgcctgg ctgaccgccc aacgaccccc gcccattgac gtcaataatg acgtatgttc

    361 ccatagtaac gccaataggg actttccatt gacgtcaatg ggtggagtat ttacggtaaa

    421 ctgcccactt ggcagtacat caagtgtatc atatgccaag tacgccccct attgacgtca

    481 atgacggtaa atggcccgcc tggcattatg cccagtacat gaccttatgg gactttccta

    541 cttggcagta catctacgta ttagtcatcg ctattaccat ggtgatgcgg ttttggcagt

    601 acatcaatgg gcgtggatag cggtttgact cacggggatt tccaagtctc caccccattg

    661 acgtcaatgg gagtttgttt tggcaccaaa atcaacggga ctttccaaaa tgtcgtaaca

    721 actccgcccc attgacgcaa atgggcggta ggcgtgtacg gtgggaggtc tatataagca

    781 gagctctctg gctaactaga gaacccactg cttactggct tatcgaaatt aatacgactc

    841 actataggga gacccaagct ggctagcgtt taaacttaag cttgcatgcc tgcaggtcga

    901 ctctagagga tccccgggta ccggtcgcca ccatggtgag caagggcgag gagctgttca

    961 ccggggtggt gcccatcctg gtcgagctgg acggcgacgt aaacggccac aagttcagcg

    1021 tgtccggcga gggcgagggc gatgccacct acggcaagct gaccctgaag ttcatctgca

    1081 ccaccggcaa gctgcccgtg ccctggccca ccctcgtgac caccttcggc tacggcctgc

    1141 agtgcttcgc ccgctacccc gaccacatga agcagcacga cttcttcaag tccgccatgc

    1201 ccgaaggcta cgtccaggag cgcaccatct tcttcaagga cgacggcaac tacaagaccc

    1261 gcgccgaggt gaagttcgag ggcgacaccc tggtgaaccg catcgagctg aagggcatcg

    1321 acttcaagga ggacggcaac atcctggggc acaagctgga gtacaactac aacagccaga

    1381 acgtctatct gatggccgac aagcagaaga acggcatcaa ggtgaacttc aagatccgcc

    1441 acaacatcga ggacggcagc gtgcagctcg ccgaccacta ccagcagaac acccccatcg

    1501 gcgacggccc cgtgctgctg cccgacaacc actacctgag ctaccagtcc gccctgagca

    1561 aagaccccaa cgagaagcgc gatcacatgg tcctgctgga gttcgtgacc gccgccggga

    1621 tcactctcgg catggacgag ctgtacaagt aaagcggccg cgactctaga attctgcaga

    1681 tatccagcac agtggcggcc gctcgagtct agagggcccg tttaaacccg ctgatcagcc

    1741 tcgactgtgc cttctagttg ccagccatct gttgtttgcc cctcccccgt gccttccttg

    1801 accctggaag gtgccactcc cactgtcctt tcctaataaa atgaggaaat tgcatcgcat

    1861 tgtctgagta ggtgtcattc tattctgggg ggtggggtgg ggcaggacag caagggggag

    1921 gattgggaag acaatagcag gcatgctggg gatgcggtgg gctctatggc ttctgaggcg

    1981 gaaagaacca gctggggctc tagggggtat ccccacgcgc cctgtagcgg cgcattaagc

    2041 gcggcgggtg tggtggttac gcgcagcgtg accgctacac ttgccagcgc cctagcgccc

    2101 gctcctttcg ctttcttccc ttcctttctc gccacgttcg ccggctttcc ccgtcaagct

    2161 ctaaatcggg ggctcccttt agggttccga tttagtgctt tacggcacct cgaccccaaa

    2221 aaacttgatt agggtgatgg ttcacgtagt gggccatcgc cctgatagac ggtttttcgc

    2281 cctttgacgt tggagtccac gttctttaat agtggactct tgttccaaac tggaacaaca

    2341 ctcaacccta tctcggtcta ttcttttgat ttataaggga ttttgccgat ttcggcctat

    2401 tggttaaaaa atgagctgat ttaacaaaaa tttaacgcga attaattctg tggaatgtgt

    2461 gtcagttagg gtgtggaaag tccccaggct ccccagcagg cagaagtatg caaagcatgc

    2521 atctcaatta gtcagcaacc aggtgtggaa agtccccagg ctccccagca ggcagaagta

    2581 tgcaaagcat gcatctcaat tagtcagcaa ccatagtccc gcccctaact ccgcccatcc

    2641 cgcccctaac tccgcccagt tccgcccatt ctccgcccca tggctgacta atttttttta

    2701 tttatgcaga ggccgaggcc gcctctgcct ctgagctatt ccagaagtag tgaggaggct

    2761 tttttggagg cctaggcttt tgcaaaaagc tcccgggagc ttgtatatcc attttcggat

    2821 ctgatcaaga gacaggatga ggatcgtttc gcatgattga acaagatgga ttgcacgcag

    2881 gttctccggc cgcttgggtg gagaggctat tcggctatga ctgggcacaa cagacaatcg

    2941 gctgctctga tgccgccgtg ttccggctgt cagcgcaggg gcgcccggtt ctttttgtca

    3001 agaccgacct gtccggtgcc ctgaatgaac tgcaggacga ggcagcgcgg ctatcgtggc

    3061 tggccacgac gggcgttcct tgcgcagctg tgctcgacgt tgtcactgaa gcgggaaggg

    3121 actggctgct attgggcgaa gtgccggggc aggatctcct gtcatctcac cttgctcctg

    3181 ccgagaaagt atccatcatg gctgatgcaa tgcggcggct gcatacgctt gatccggcta

    3241 cctgcccatt cgaccaccaa gcgaaacatc gcatcgagcg agcacgtact cggatggaag

    3301 ccggtcttgt cgatcaggat gatctggacg aagagcatca ggggctcgcg ccagccgaac

    3361 tgttcgccag gctcaaggcg cgcatgcccg acggcgagga tctcgtcgtg acccatggcg

    3421 atgcctgctt gccgaatatc atggtggaaa atggccgctt ttctggattc atcgactgtg

    3481 gccggctggg tgtggcggac cgctatcagg acatagcgtt ggctacccgt gatattgctg

    3541 aagagcttgg cggcgaatgg gctgaccgct tcctcgtgct ttacggtatc gccgctcccg

    3601 attcgcagcg catcgccttc tatcgccttc ttgacgagtt cttctgagcg ggactctggg

    3661 gttcgaaatg accgaccaag cgacgcccaa cctgccatca cgagatttcg attccaccgc

    3721 cgccttctat gaaaggttgg gcttcggaat cgttttccgg gacgccggct ggatgatcct

    3781 ccagcgcggg gatctcatgc tggagttctt cgcccacccc aacttgttta ttgcagctta

    3841 taatggttac aaataaagca atagcatcac aaatttcaca aataaagcat ttttttcact

    3901 gcattctagt tgtggtttgt ccaaactcat caatgtatct tatcatgtct gtataccgtc

    3961 gacctctagc tagagcttgg cgtaatcatg gtcatagctg tttcctgtgt gaaattgtta

    4021 tccgctcaca attccacaca acatacgagc cggaagcata aagtgtaaag cctggggtgc

    4081 ctaatgagtg agctaactca cattaattgc gttgcgctca ctgcccgctt tccagtcggg

    4141 aaacctgtcg tgccagctgc attaatgaat cggccaacgc gcggggagag gcggtttgcg

    4201 tattgggcgc tcttccgctt cctcgctcac tgactcgctg cgctcggtcg ttcggctgcg

    4261 gcgagcggta tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa

    4321 cgcaggaaag aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc

    4381 gttgctggcg tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc

    4441 aagtcagagg tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag

    4501 ctccctcgtg cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct

    4561 cccttcggga agcgtggcgc tttctcatag ctcacgctgt aggtatctca gttcggtgta

    4621 ggtcgttcgc tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc

    4681 cttatccggt aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc

    4741 agcagccact ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt

    4801 gaagtggtgg cctaactacg gctacactag aagaacagta tttggtatct gcgctctgct

    4861 gaagccagtt accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc

    4921 tggtagcggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga

    4981 agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact cacgttaagg

    5041 gattttggtc atgagattat caaaaaggat cttcacctag atccttttaa attaaaaatg

    5101 aagttttaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt accaatgctt

    5161 aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag ttgcctgact

    5221 ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca gtgctgcaat

    5281 gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc agccagccgg

    5341 aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt ctattaattg

    5401 ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg ttgttgccat

    5461 tgctacaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca gctccggttc

    5521 ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg ttagctcctt

    5581 cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca tggttatggc

    5641 agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg tgactggtga

    5701 gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct cttgcccggc

    5761 gtcaatacgg gataataccg cgccacatag cagaacttta aaagtgctca tcattggaaa

    5821 acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca gttcgatgta

    5881 acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg tttctgggtg

    5941 agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac ggaaatgttg

    6001 aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt attgtctcat

    6061 gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc cgcgcacatt

    6121 tccccgaaaa gtgccacctg acgtcgacgg atcgggagat ctcccgatcc cctatggt

    //

     

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.