PG+HOST9, 2 ug

https://www.gentaur.be/web/image/product.template/641/image_1920?unique=dfe4bd9

807,52 лв 807.52 BGN 807,52 лв

412,00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    pG+HOST9

    Catalog No. PVT11382
    Packing 2ug

     

    pG+HOST9 Information

    Replicon: repA

    Plasmid classification: other host plasmids; other series of plasmids.

    Plasmid size: 3752bp

    Competent cells: MC1061

    Prokaryotic resistance: erythromycin Erm 200 μg/ml

    Culture conditions: 37℃

    Alias: pG-HOST9

     

     

    pG+HOST9 Description

    PG+HOST9  is a thermosensitive integrated carrier of lactic acid bacteria and other gram positive bacteria.

     

     

    pG+HOST9 Sequence

    LOCUS       Exported                3752 bp ds-DNA     circular SYN 21-SEP-2017

    DEFINITION  synthetic circular DNA

    SOURCE      synthetic DNA construct

      ORGANISM  synthetic DNA construct

    REFERENCE   1  (bases 1 to 3752)

      TITLE     Direct Submission

      JOURNAL   Exported Sep 21, 2017

    FEATURES             Location/Qualifiers

         source          1..3752

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         CDS             complement(151..888)

                         /codon_start=1

                         /label=Erm

                         /translation="MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTT

                         KLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYH

                         LSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFH

                         PKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNN

                         LSTVTYEQVLSIFNSYLLFNGRK"

         CDS             2216..2914

                         /codon_start=1

                         /label=repA

                         /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE

                         KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD

                         YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV

                         DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK

                         VLDAETGEIK"

         promoter        3647..3665

                         /label=T7 promoter

                         /note="promoter for bacteriophage T7 RNA polymerase"

         misc_feature    3674..3751

                         /label=MCS

    ORIGIN

            1 ctagagcggc cgccaccgcg gtgggatcct ctagagtccg ctagggacct ctttagctcc

           61 ttggaagctg tcagtagtat acctaataat ttatctacat tccctttagt aacgtgtaac

          121 tttccaaatt tacaaaagcg actcatagaa ttatttcctc ccgttaaata atagataact

          181 attaaaaata gacaatactt gctcataagt aacggtactt aaattgttta ctttggcgtg

          241 tttcattgct tgatgaaact gatttttagt aaacagttga cgatattctc gattgaccca

          301 ttttgaaaca aagtacgtat atagcttcca atatttatct ggaacatctg tggtatggcg

          361 ggtaagtttt attaagacac tgtttacttt tggtttagga tgaaagcatt ccgctggcag

          421 cttaagcaat tgctgaatcg agacttgagt gtgcaagagc aaccctagtg ttcggtgaat

          481 atccaaggta cgcttgtaga atccttcttc aacaatcaga tagatgtcag acgcatggct

          541 ttcaaaaacc acttttttaa taatttgtgt gcttaaatgg taaggaatac tcccaacaat

          601 tttatacctc tgtttgttag ggaattgaaa ctgtagaata tcttggtgaa ttaaagtgac

          661 acgagtattc agttttaatt tttctgacga taagttgaat agatgactgt ctaattcaat

          721 agacgttacc tgtttactta ttttagccag tttcgtcgtt aaatgccctt tacctgttcc

          781 aatttcgtaa acggtatcgg tttcttttaa attcaattgt tttattattt ggttgagtac

          841 tttttcactc gttaaaaagt tttgagaata ttttatattt ttgttcatgt aatcactcct

          901 tcttaattac aaatttttag catctaattt aacttcaatt cctattatac aaaattttaa

          961 gatactgcac tatcaacaca ctcttaagtt tgcttctaag tcttatttcc ataacttctt

         1021 ttacgtttcc gccattcttt gctgtttcga tttttatgat atggtgcaag tcagcacgaa

         1081 cacgaaccgt cttatctccc attatatctt tttttgcact gattggtgta tcatttcgtt

         1141 tttcttttgc gcgactctag aggatcctga taaatatgaa catgatgagt gatcgttaaa

         1201 tttatactgc aatcggatgc gattattgaa taaaagatat gagagattta tctaatttct

         1261 tttttcttgt aaaaaaagaa agttcttaaa ggttttatag ttttggtcgt agagcacacg

         1321 gtttaacgac ttaattacga agtaaataag tctagtgtgt tagactttat gaaatctata

         1381 tacgtttata tatatttatt atccgatttt ttattaaaac gtctcaaaat cgtttctgag

         1441 acgttttagc gtttatttcg tttagttatc ggcataatcg ttaaaacagg cgttatcgta

         1501 gcgtaaaagc ccttgagcgt agcgtggctt tgcagcgaag atgttgtctg ttagattatg

         1561 aaagccgatg actgaatgaa ataataagcg cagcgccctt ctatttcggt tggaggaggc

         1621 tcaagggagt atgagggaat gaaattccct catgggtttg attttaaaaa ttgcttgcaa

         1681 ttttgccgag cggtagcgct ggaaaatttt tgaaaaaaat ttggaatttg gaaaaaaatg

         1741 gggggaaagg aagcgaattt tgcttccgta ctacgacccc ccattaagtg ccgagtgcca

         1801 atttttgtgc caaaaacgct ctatcccaac tggctcaagg gtttaagggg tttttcaatc

         1861 gccaacgaat cgccaacgtt ttcgccaacg ttttttataa atctatattt aagtagcttt

         1921 attgttgttt ttatgattac aaagtgatac actaacttta taaaattatt tgattggagt

         1981 tttttaaatg gtgatttcag aatcgaaaaa aagagttatg atttctctga caaaagagca

         2041 agataaaaaa ttaacagata tggcgaaaca aaaaggtttt tcaaaatctg cggttgcggc

         2101 gttagctata gaagaatatg caagaaagga atcagaacaa aaaaaataag cgaaagctcg

         2161 cgtttttaga aggatacgag ttttcgctac ttgtttttga taaggtaatt atatcatggc

         2221 tattaaaaat actaaagcta gaaattttgg atttttatta tatcctgact caattcctaa

         2281 tgattggaaa gaaaaattag agagtttggg cgtatctatg gctgtcagtc ctttacacga

         2341 tatggacgaa aaaaaagata aagatacatg gaataatagt aatattatac aaaatggaaa

         2401 gcactataaa aaaccacact atcacgttat atatattgca cgaaatcctg taacaataga

         2461 aagcgttagg aacaagatta agcgaaaatt ggggaatagt tcagttgctc atgttgagat

         2521 acttgattat atcaaaggtt catatgaata tttgactcat gaatcaaagg acgctattgc

         2581 taagaataaa catatatacg acaaaaaaga tattttgaac attaatgatt ttgatattga

         2641 ccgctatata acacttgatg aaagccaaaa aagagaattg aagaatttac ttttagatat

         2701 agtggatgac tataatttgg taaatacaaa agatttaatg gcttttattc gccttagggg

         2761 agcggagttt ggaattttaa atacgaatga tgtaaaagat attgtttcaa caaactctag

         2821 cgcctttaga ttatggtttg agggcaatta tcagtgtgga tatagagcaa gttatgcaaa

         2881 ggttcttgat gctgaaacgg gggaaataaa atgacaaaca aagaaaaaga gttatttgct

         2941 gaaaatgagg aattaaaaaa agaaattaag gacttaaaag agcgtattga aagatacaga

         3001 gaaatggaag ttgaattaag tacaacaata gatttattga gaggagggat tattgaataa

         3061 ataaaagccc cctgacgaaa gtcgaagggg gtttttattt tggtttgatg ttgcgattaa

         3121 tagcaataca attgcaataa acaaaatgat cttccttcag gttatgacca tctgtgccag

         3181 ttcgtaatgt ctggtcaact ttccgactct gagaaacttc tggaatcgct agagaatttc

         3241 tggaatggga ttcaggagtg gacagaacga cacggatata tagtggatgt gtcaaaacgc

         3301 ataccatttt gaacgatgac ctctaataat tgttaatcat gttggttacg tatttattaa

         3361 cttctcctag tattagtaat tatcatggct gtcatggcgc attaacggaa taaagggtgt

         3421 gcttaaatcg ggccattttg cgtaataaga aaaaggatta attatgagcg aattgaatta

         3481 ataataaggt aatagattta cattagaaaa tgaaagggga ttttatgcgt gagaatgtta

         3541 cagtctatcc ctggcgaaag ggggatgtgc tgcaaggcga ttaagttggg taacgccagg

         3601 gttttcccag tcacgacgtt gtaaaacgac ggccagtgag cgcgcgtaat acgactcact

         3661 atagggcgaa ttgggtaccg ggccccccct cgaggtcgac ggtatcgata agcttgatat

         3721 cgaattcctg cagcccgggg gatccactag tt

    //

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.