pHelper - PVT2101

https://www.gen.bg/web/image/product.template/36/image_1920?unique=79d2676

558,46 лв 558.46 BGN 558,46 лв

284,93 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    pHelper

    PVT2101    2ug

     

    pHelper Information

    Replicator: pUC ori, F1 ori

    Plasmid classification: virus series, adenovirus associated packaging vector

    Plasmid size: 11635bp

    Prokaryotic resistance: Amp

    Cloned strain: Stbl3

    Culture conditions: 37 centigrade, aerobic, LB

    Expression host: mammalian cells

    Induction mode: no induction, instantaneous expression

    5'sequencing primers: primers designed according to sequence

    3'sequencing primers: primers designed according to sequence

     

    pHelper Description

    pHelper is a vector of 11.6 KB, carries the adenovirus genes (E2A E4 and VA RNAs required inducing the lytic) for phase of AAV. This vector is cotransfected into the packaging cell line to produce recombinant replication-deficient AAV virions., it is related to packaging adenovirus vector with ampicillin resistance.

     

    pHelper Sequence

    LOCUS       Exported               11635 bp ds-DNA     circular SYN 15-AUG-2018

    DEFINITION  synthetic circular DNA

    KEYWORDS    pHelper

    SOURCE      synthetic DNA construct

      ORGANISM  synthetic DNA construct

    REFERENCE   1  (bases 1 to 11635)

      AUTHORS   Triple Threat

      TITLE     Direct Submission

    FEATURES             Location/Qualifiers

         source          1..11635

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         misc_feature    complement(1..5336)

                         /note="adeno E2A"

         misc_feature    5337..8537

                         /note="adeno E4"

         misc_feature    complement(8538..9280)

                         /note="adeno VA"

         rep_origin      complement(9423..10011)

                         /direction=LEFT

                         /note="ori"

                         /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                         replication"

         CDS             complement(10182..11042)

                         /codon_start=1

                         /gene="bla"

                         /product="beta-lactamase"

                         /note="AmpR"

                         /note="confers resistance to ampicillin, carbenicillin, and

                         related antibiotics"

                         /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                         ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                         PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                         EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                         LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                         LIKHW"

         promoter        complement(11043..11147)

                         /gene="bla"

                         /note="AmpR promoter"

         rep_origin      complement(11173..11627)

                         /direction=LEFT

                         /note="f1 ori"

                         /note="f1 bacteriophage origin of replication; arrow 

                         indicates direction of (+) strand synthesis"

    ORIGIN

            1 ggtacccaac tccatgctta acagtcccca ggtacagccc accctgcgtc gcaaccagga

           61 acagctctac agcttcctgg agcgccactc gccctacttc cgcagccaca gtgcgcagat

          121 taggagcgcc acttcttttt gtcacttgaa aaacatgtaa aaataatgta ctaggagaca

          181 ctttcaataa aggcaaatgt ttttatttgt acactctcgg gtgattattt accccccacc

          241 cttgccgtct gcgccgttta aaaatcaaag gggttctgcc gcgcatcgct atgcgccact

          301 ggcagggaca cgttgcgata ctggtgttta gtgctccact taaactcagg cacaaccatc

          361 cgcggcagct cggtgaagtt ttcactccac aggctgcgca ccatcaccaa cgcgtttagc

          421 aggtcgggcg ccgatatctt gaagtcgcag ttggggcctc cgccctgcgc gcgcgagttg

          481 cgatacacag ggttgcagca ctggaacact atcagcgccg ggtggtgcac gctggccagc

          541 acgctcttgt cggagatcag atccgcgtcc aggtcctccg cgttgctcag ggcgaacgga

          601 gtcaactttg gtagctgcct tcccaaaaag ggtgcatgcc caggctttga gttgcactcg

          661 caccgtagtg gcatcagaag gtgaccgtgc ccggtctggg cgttaggata cagcgcctgc

          721 atgaaagcct tgatctgctt aaaagccacc tgagcctttg cgccttcaga gaagaacatg

          781 ccgcaagact tgccggaaaa ctgattggcc ggacaggccg cgtcatgcac gcagcacctt

          841 gcgtcggtgt tggagatctg caccacattt cggccccacc ggttcttcac gatcttggcc

          901 ttgctagact gctccttcag cgcgcgctgc ccgttttcgc tcgtcacatc catttcaatc

          961 acgtgctcct tatttatcat aatgctcccg tgtagacact taagctcgcc ttcgatctca

         1021 gcgcagcggt gcagccacaa cgcgcagccc gtgggctcgt ggtgcttgta ggttacctct

         1081 gcaaacgact gcaggtacgc ctgcaggaat cgccccatca tcgtcacaaa ggtcttgttg

         1141 ctggtgaagg tcagctgcaa cccgcggtgc tcctcgttta gccaggtctt gcatacggcc

         1201 gccagagctt ccacttggtc aggcagtagc ttgaagtttg cctttagatc gttatccacg

         1261 tggtacttgt ccatcaacgc gcgcgcagcc tccatgccct tctcccacgc agacacgatc

         1321 ggcaggctca gcgggtttat caccgtgctt tcactttccg cttcactgga ctcttccttt

         1381 tcctcttgcg tccgcatacc ccgcgccact gggtcgtctt cattcagccg ccgcaccgtg

         1441 cgcttacctc ccttgccgtg cttgattagc accggtgggt tgctgaaacc caccatttgt

         1501 agcgccacat cttctctttc ttcctcgctg tccacgatca cctctgggga tggcgggcgc

         1561 tcgggcttgg gagaggggcg cttctttttc tttttggacg caatggccaa atccgccgtc

         1621 gaggtcgatg gccgcgggct gggtgtgcgc ggcaccagcg catcttgtga cgagtcttct

         1681 tcgtcctcgg actcgagacg ccgcctcagc cgcttttttg ggggcgcgcg gggaggcggc

         1741 ggcgacggcg acggggacga cacgtcctcc atggttggtg gacgtcgcgc cgcaccgcgt

         1801 ccgcgctcgg gggtggtttc gcgctgctcc tcttcccgac tggccatttc cttctcctat

         1861 aggcagaaaa agatcatgga gtcagtcgag aaggaggaca gcctaaccgc cccctttgag

         1921 ttcgccacca ccgcctccac cgatgccgcc aacgcgccta ccaccttccc cgtcgaggca

         1981 cccccgcttg aggaggagga agtgattatc gagcaggacc caggttttgt aagcgaagac

         2041 gacgaggatc gctcagtacc aacagaggat aaaaagcaag accaggacga cgcagaggca

         2101 aacgaggaac aagtcgggcg gggggaccaa aggcatggcg actacctaga tgtgggagac

         2161 gacgtgctgt tgaagcatct gcagcgccag tgcgccatta tctgcgacgc gttgcaagag

         2221 cgcagcgatg tgcccctcgc catagcggat gtcagccttg cctacgaacg ccacctgttc

         2281 tcaccgcgcg taccccccaa acgccaagaa aacggcacat gcgagcccaa cccgcgcctc

         2341 aacttctacc ccgtatttgc cgtgccagag gtgcttgcca cctatcacat ctttttccaa

         2401 aactgcaaga tacccctatc ctgccgtgcc aaccgcagcc gagcggacaa gcagctggcc

         2461 ttgcggcagg gcgctgtcat acctgatatc gcctcgctcg acgaagtgcc aaaaatcttt

         2521 gagggtcttg gacgcgacga gaaacgcgcg gcaaacgctc tgcaacaaga aaacagcgaa

         2581 aatgaaagtc actgtggagt gctggtggaa cttgagggtg acaacgcgcg cctagccgtg

         2641 ctgaaacgca gcatcgaggt cacccacttt gcctacccgg cacttaacct accccccaag

         2701 gttatgagca cagtcatgag cgagctgatc gtgcgccgtg cacgacccct ggagagggat

         2761 gcaaacttgc aagaacaaac cgaggagggc ctacccgcag ttggcgatga gcagctggcg

         2821 cgctggcttg agacgcgcga gcctgccgac ttggaggagc gacgcaagct aatgatggcc

         2881 gcagtgcttg ttaccgtgga gcttgagtgc atgcagcggt tctttgctga cccggagatg

         2941 cagcgcaagc tagaggaaac gttgcactac acctttcgcc agggctacgt gcgccaggcc

         3001 tgcaaaattt ccaacgtgga gctctgcaac ctggtctcct accttggaat tttgcacgaa

         3061 aaccgcctcg ggcaaaacgt gcttcattcc acgctcaagg gcgaggcgcg ccgcgactac

         3121 gtccgcgact gcgtttactt atttctgtgc tacacctggc aaacggccat gggcgtgtgg

         3181 cagcaatgcc tggaggagcg caacctaaag gagctgcaga agctgctaaa gcaaaacttg

         3241 aaggacctat ggacggcctt caacgagcgc tccgtggccg cgcacctggc ggacattatc

         3301 ttccccgaac gcctgcttaa aaccctgcaa cagggtctgc cagacttcac cagtcaaagc

         3361 atgttgcaaa actttaggaa ctttatccta gagcgttcag gaattctgcc cgccacctgc

         3421 tgtgcgcttc ctagcgactt tgtgcccatt aagtaccgtg aatgccctcc gccgctttgg

         3481 ggtcactgct accttctgca gctagccaac taccttgcct accactccga catcatggaa

         3541 gacgtgagcg gtgacggcct actggagtgt cactgtcgct gcaacctatg caccccgcac

         3601 cgctccctgg tctgcaattc gcaactgctt agcgaaagtc aaattatcgg tacctttgag

         3661 ctgcagggtc cctcgcctga cgaaaagtcc gcggctccgg ggttgaaact cactccgggg

         3721 ctgtggacgt cggcttacct tcgcaaattt gtacctgagg actaccacgc ccacgagatt

         3781 aggttctacg aagaccaatc ccgcccgcca aatgcggagc ttaccgcctg cgtcattacc

         3841 cagggccaca tccttggcca attgcaagcc atcaacaaag cccgccaaga gtttctgcta

         3901 cgaaagggac ggggggttta cctggacccc cagtccggcg aggagctcaa cccaatcccc

         3961 ccgccgccgc agccctatca gcagccgcgg gcccttgctt cccaggatgg cacccaaaaa

         4021 gaagctgcag ctgccgccgc cgccacccac ggacgaggag gaatactggg acagtcaggc

         4081 agaggaggtt ttggacgagg aggaggagat gatggaagac tgggacagcc tagacgaagc

         4141 ttccgaggcc gaagaggtgt cagacgaaac accgtcaccc tcggtcgcat tcccctcgcc

         4201 ggcgccccag aaattggcaa ccgttcccag catcgctaca acctccgctc ctcaggcgcc

         4261 gccggcactg cctgttcgcc gacccaaccg tagatgggac accactggaa ccagggccgg

         4321 taagtctaag cagccgccgc cgttagccca agagcaacaa cagcgccaag gctaccgctc

         4381 gtggcgcggg cacaagaacg ccatagttgc ttgcttgcaa gactgtgggg gcaacatctc

         4441 cttcgcccgc cgctttcttc tctaccatca cggcgtggcc ttcccccgta acatcctgca

         4501 ttactaccgt catctctaca gcccctactg caccggcggc agcggcagcg gcagcaacag

         4561 cagcggtcac acagaagcaa aggcgaccgg atagcaagac tctgacaaag cccaagaaat

         4621 ccacagcggc ggcagcagca ggaggaggag cgctgcgtct ggcgcccaac gaacccgtat

         4681 cgacccgcga gcttagaaat aggatttttc ccactctgta tgctatattt caacaaagca

         4741 ggggccaaga acaagagctg aaaataaaaa acaggtctct gcgctccctc acccgcagct

         4801 gcctgtatca caaaagcgaa gatcagcttc ggcgcacgct ggaagacgcg gaggctctct

         4861 tcagcaaata ctgcgcgctg actcttaagg actagtttcg cgccctttct caaatttaag

         4921 cgcgaaaact acgtcatctc cagcggccac acccggcgcc agcacctgtc gtcagcgcca

         4981 ttatgagcaa ggaaattccc acgccctaca tgtggagtta ccagccacaa atgggacttg

         5041 cggctggagc tgcccaagac tactcaaccc gaataaacta catgagcgcg ggaccccaca

         5101 tgatatcccg ggtcaacgga atccgcgccc accgaaaccg aattctcctc gaacaggcgg

         5161 ctattaccac cacacctcgt aataacctta atccccgtag ttggcccgct gccctggtgt

         5221 accaggaaag tcccgctccc accactgtgg tacttcccag agacgcccag gccgaagttc

         5281 agatgactaa ctcaggggcg cagcttgcgg gcggctttcg tcacagggtg cggtcgcccg

         5341 ggcgttttag ggcggagtaa cttgcatgta ttgggaattg tagttttttt aaaatgggaa

         5401 gtgacgtatc gtgggaaaac ggaagtgaag atttgaggaa gttgtgggtt ttttggcttt

         5461 cgtttctggg cgtaggttcg cgtgcggttt tctgggtgtt ttttgtggac tttaaccgtt

         5521 acgtcatttt ttagtcctat atatactcgc tctgtacttg gcccttttta cactgtgact

         5581 gattgagctg gtgccgtgtc gagtggtgtt ttttaatagg tttttttact ggtaaggctg

         5641 actgttatgg ctgccgctgt ggaagcgctg tatgttgttc tggagcggga gggtgctatt

         5701 ttgcctaggc aggagggttt ttcaggtgtt tatgtgtttt tctctcctat taattttgtt

         5761 atacctccta tgggggctgt aatgttgtct ctacgcctgc gggtatgtat tcccccgggc

         5821 tatttcggtc gctttttagc actgaccgat gttaaccaac ctgatgtgtt taccgagtct

         5881 tacattatga ctccggacat gaccgaggaa ctgtcggtgg tgctttttaa tcacggtgac

         5941 cagttttttt acggtcacgc cggcatggcc gtagtccgtc ttatgcttat aagggttgtt

         6001 tttcctgttg taagacaggc ttctaatgtt taaatgtttt tttttttgtt attttatttt

         6061 gtgtttaatg caggaacccg cagacatgtt tgagagaaaa atggtgtctt tttctgtggt

         6121 ggttccggaa cttacctgcc tttatctgca tgagcatgac tacgatgtgc ttgctttttt

         6181 gcgcgaggct ttgcctgatt ttttgagcag caccttgcat tttatatcgc cgcccatgca

         6241 acaagcttac ataggggcta cgctggttag catagctccg agtatgcgtg tcataatcag

         6301 tgtgggttct tttgtcatgg ttcctggcgg ggaagtggcc gcgctggtcc gtgcagacct

         6361 gcacgattat gttcagctgg ccctgcgaag ggacctacgg gatcgcggta tttttgttaa

         6421 tgttccgctt ttgaatctta tacaggtctg tgaggaacct gaatttttgc aatcatgatt

         6481 cgctgcttga ggctgaaggt ggagggcgct ctggagcaga tttttacaat ggccggactt

         6541 aatattcggg atttgcttag agacatattg ataaggtggc gagatgaaaa ttatttgggc

         6601 atggttgaag gtgctggaat gtttatagag gagattcacc ctgaagggtt tagcctttac

         6661 gtccacttgg acgtgagggc agtttgcctt ttggaagcca ttgtgcaaca tcttacaaat

         6721 gccattatct gttctttggc tgtagagttt gaccacgcca ccggagggga gcgcgttcac

         6781 ttaatagatc ttcattttga ggttttggat aatcttttgg aataaaaaaa aaaaaacatg

         6841 gttcttccag ctcttcccgc tcctcccgtg tgtgactcgc agaacgaatg tgtaggttgg

         6901 ctgggtgtgg cttattctgc ggtggtggat gttatcaggg cagcggcgca tgaaggagtt

         6961 tacatagaac ccgaagccag ggggcgcctg gatgctttga gagagtggat atactacaac

         7021 tactacacag agcgagctaa gcgacgagac cggagacgca gatctgtttg tcacgcccgc

         7081 acctggtttt gcttcaggaa atatgactac gtccggcgtt ccatttggca tgacactacg

         7141 accaacacga tctcggttgt ctcggcgcac tccgtacagt agggatcgcc tacctccttt

         7201 tgagacagag acccgcgcta ccatactgga ggatcatccg ctgctgcccg aatgtaacac

         7261 tttgacaatg cacaacgtga gttacgtgcg aggtcttccc tgcagtgtgg gatttacgct

         7321 gattcaggaa tgggttgttc cctgggatat ggttctgacg cgggaggagc ttgtaatcct

         7381 gaggaagtgt atgcacgtgt gcctgtgttg tgccaacatt gatatcatga cgagcatgat

         7441 gatccatggt tacgagtcct gggctctcca ctgtcattgt tccagtcccg gttccctgca

         7501 gtgcatagcc ggcgggcagg ttttggccag ctggtttagg atggtggtgg atggcgccat

         7561 gtttaatcag aggtttatat ggtaccggga ggtggtgaat tacaacatgc caaaagaggt

         7621 aatgtttatg tccagcgtgt ttatgagggg tcgccactta atctacctgc gcttgtggta

         7681 tgatggccac gtgggttctg tggtccccgc catgagcttt ggatacagcg ccttgcactg

         7741 tgggattttg aacaatattg tggtgctgtg ctgcagttac tgtgctgatt taagtgagat

         7801 cagggtgcgc tgctgtgccc ggaggacaag gcgtctcatg ctgcgggcgg tgcgaatcat

         7861 cgctgaggag accactgcca tgttgtattc ctgcaggacg gagcggcggc ggcagcagtt

         7921 tattcgcgcg ctgctgcagc accaccgccc tatcctgatg cacgattatg actctacccc

         7981 catgtaggcg tggacttccc cttcgccgcc cgttgagcaa ccgcaagttg gacagcagcc

         8041 tgtggctcag cagctggaca gcgacatgaa cttaagcgag ctgcccgggg agtttattaa

         8101 tatcactgat gagcgtttgg ctcgacagga aaccgtgtgg aatataacac ctaagaatat

         8161 gtctgttacc catgatatga tgctttttaa ggccagccgg ggagaaagga ctgtgtactc

         8221 tgtgtgttgg gagggaggtg gcaggttgaa tactagggtt ctgtgagttt gattaaggta

         8281 cggtgatcaa tataagctat gtggtggtgg ggctatacta ctgaatgaaa aatgacttga

         8341 aattttctgc aattgaaaaa taaacacgtt gaaacataac atgcaacagg ttcacgattc

         8401 tttattcctg ggcaatgtag gagaaggtgt aagagttggt agcaaaagtt tcagtggtgt

         8461 attttccact ttcccaggac catgtaaaag acatagagta agtgcttacc tcgctagttt

         8521 ctgtggattc actagaatcg atgtaggatg ttgcccctcc tgacgcggta ggagaagggg

         8581 agggtgccct gcatgtctgc cgctgctctt gctcttgccg ctgctgagga ggggggcgca

         8641 tctgccgcag caccggatgc atctgggaaa agcaaaaaag gggctcgtcc ctgtttccgg

         8701 aggaatttgc aagcggggtc ttgcatgacg gggaggcaaa cccccgttcg ccgcagtccg

         8761 gccggcccga gactcgaacc gggggtcctg cgactcaacc cttggaaaat aaccctccgg

         8821 ctacagggag cgagccactt aatgctttcg ctttccagcc taaccgctta cgccgcgcgc

         8881 ggccagtggc caaaaaagct agcgcagcag ccgccgcgcc tggaaggaag ccaaaaggag

         8941 cgctcccccg ttgtctgacg tcgcacacct gggttcgaca cgcgggcggt aaccgcatgg

         9001 atcacggcgg acggccggat ccggggttcg aaccccggtc gtccgccatg atacccttgc

         9061 gaatttatcc accagaccac ggaagagtgc ccgcttacag gctctccttt tgcacggtct

         9121 agagcgtcaa cgactgcgca cgcctcaccg gccagagcgt cccgaccatg gagcactttt

         9181 tgccgctgcg caacatctgg aaccgcgtcc gcgactttcc gcgcgcctcc accaccgccg

         9241 ccggcatcac ctggatgtcc aggtacatct acggattacg tcgacgttta aaccatatga

         9301 tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa cgcaggaaag

         9361 aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg

         9421 tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg

         9481 tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg

         9541 cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct cccttcggga

         9601 agcgtggcgc tttctcatag ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc

         9661 tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc cttatccggt

         9721 aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc agcagccact

         9781 ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt gaagtggtgg

         9841 cctaactacg gctacactag aagaacagta tttggtatct gcgctctgct gaagccagtt

         9901 accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc tggtagcggt

         9961 ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca agaagatcct

        10021 ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta agggattttg

        10081 gtcatgagat tatcaaaaag gatcttcacc tagatccttt taaattaaaa atgaagtttt

        10141 aaatcaatct aaagtatata tgagtaaact tggtctgaca gttaccaatg cttaatcagt

        10201 gaggcaccta tctcagcgat ctgtctattt cgttcatcca tagttgcctg actccccgtc

        10261 gtgtagataa ctacgatacg ggagggctta ccatctggcc ccagtgctgc aatgataccg

        10321 cgagacccac gctcaccggc tccagattta tcagcaataa accagccagc cggaagggcc

        10381 gagcgcagaa gtggtcctgc aactttatcc gcctccatcc agtctattaa ttgttgccgg

        10441 gaagctagag taagtagttc gccagttaat agtttgcgca acgttgttgc cattgctaca

        10501 ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat tcagctccgg ttcccaacga

        10561 tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag cggttagctc cttcggtcct

        10621 ccgatcgttg tcagaagtaa gttggccgca gtgttatcac tcatggttat ggcagcactg

        10681 cataattctc ttactgtcat gccatccgta agatgctttt ctgtgactgg tgagtactca

        10741 accaagtcat tctgagaata gtgtatgcgg cgaccgagtt gctcttgccc ggcgtcaata

        10801 cgggataata ccgcgccaca tagcagaact ttaaaagtgc tcatcattgg aaaacgttct

        10861 tcggggcgaa aactctcaag gatcttaccg ctgttgagat ccagttcgat gtaacccact

        10921 cgtgcaccca actgatcttc agcatctttt actttcacca gcgtttctgg gtgagcaaaa

        10981 acaggaaggc aaaatgccgc aaaaaaggga ataagggcga cacggaaatg ttgaatactc

        11041 atactcttcc tttttcaata ttattgaagc atttatcagg gttattgtct catgagcgga

        11101 tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac atttccccga

        11161 aaagtgccac ctaaattgta agcgttaata ttttgttaaa attcgcgtta aatttttgtt

        11221 aaatcagctc attttttaac caataggccg aaatcggcaa aatcccttat aaatcaaaag

        11281 aatagaccga gatagggttg agtgttgttc cagtttggaa caagagtcca ctattaaaga

        11341 acgtggactc caacgtcaaa gggcgaaaaa ccgtctatca gggcgatggc ccactacgtg

        11401 aaccatcacc ctaatcaagt tttttggggt cgaggtgccg taaagcacta aatcggaacc

        11461 ctaaagggag cccccgattt agagcttgac ggggaaagcc ggcgaacgtg gcgagaaagg

        11521 aagggaagaa agcgaaagga gcgggcgcta gggcgctggc aagtgtagcg gtcacgctgc

        11581 gcgtaaccac cacacccgcc gcgcttaatg cgccgctaca gggcgcgatg gatcc

    //

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.