pSET152 Vector - 2 ug

https://www.gentaur.be/web/image/product.template/3620/image_1920?unique=2cfa98a

917,28 лв 917.28 BGN 917,28 лв

468,00 €

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    pSET152 vector

    Packing 2ug

     

    pSET152 vector Information

    Promoter: No, it needs to be cloned by itself

    Prokaryotic Apramycin resistance: Apr

    Screening marker: Apramycin Apr

    Cloned strain: Escherichia coli DH5 alpha

    Culture conditions: 30 degrees centigrade

    Expression host: Streptomyces, actinomycetes, etc.

     

    pSET152 vector Description

    pSET152 vector is a integrated expression plasmid of Streptomyces. PSET152 vector can integrate exogenous genes into Streptomyces genome, and is a commonly used gene delivery vector for Streptomyces genome to express highly specific genes.

     

    pSET152 vector Sequence

    LOCUS       Exported                5715 bp ds-DNA     circular SYN 27-JAN-2018

    FEATURES             Location/Qualifiers

         source          1..5715

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         CDS             complement(163..507)

                         /codon_start=1

                         /gene="lacZ fragment"

                         /product="LacZ-alpha fragment of beta-galactosidase"

                         /label=lacZ-alpha

                         /translation="MITNSISRAAADPLESTCSPSLALAVVLQRRDWENPGVTQLNRLA

                         AHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRINSPMSSTSGIG

                         SAADAKCRST"

         rep_origin      complement(910..1498)

                         /direction=LEFT

                         /label=ori

                         /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                         replication"

         CDS             1702..2502

                         /codon_start=1

                         /gene="aac(3)IV"

                         /product="aminoglycoside 3-N-acetyltransferase type IV     

                                   "

                         /label=Apr

                         /note="confers resistance to apramycin (Paget and Davies, 

                         1996)"

                         /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP

                         LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV

                         KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH

                         LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH

                         AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG"

         CDS             complement(2936..3307)

                         /codon_start=1

                         /gene="traJ"

                         /product="oriT-recognizing protein"

                         /label=traJ

                         /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                         GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                         KQDELGKVMMGVVRPRAEP"

         oriT            3340..3449

                         /note="incP origin of transfer"

         protein_bind    3769..3868

                         /label=phage phi-C31 attP

                         /bound_moiety="phage phi-C31 integrase"

                         /note="attachment site of phage phi-C31"

         CDS             3878..5695

                         /codon_start=1

                         /product="integrase from phage phi-C31"

                         /label=phage phi-C31 integrase

                         /translation="MDTYAGAYDRQSRERENSSAASPATQRSANEDKAADLQREVERDG

                         GRFRFVGHFSEAPGTSAFGTAERPEFERILNECRAGRLNMIIVYDVSRFSRLKVMDAIP

                         IVSELLALGVTIVSTQEGVFRQGNVMDLIHLIMRLDASHKESSLKSAKILDTKNLQREL

                         GGYVGGKAPYGFELVSETKEITRNGRMVNVVINKLAHSTTPLTGPFEFEPDVIRWWWRE

                         IKTHKHLPFKPGSQAAIHPGSITGLCKRMDADAVPTRGETIGKKTASSAWDPATVMRIL

                         RDPRIAGFAAEVIYKKKPDGTPTTKIEGYRIQRDPITLRPVELDCGPIIEPAEWYELQA

                         WLDGRGRGKGLSRGQAILSAMDKLYCECGAVMTSKRGEESIKDSYRCRRRKVVDPSAPG

                         QHEGTCNVSMAALDKFVAERIFNKIRHAEGDEETLALLWEAARRFGKLTEAPEKSGERA

                         NLVAERADALNALEELYEDRAAGAYDGPVGRKHFRKQQAALTLRQQGAEERLAELEAAE

                         APKLPLDQWFPEDADADPTGPKSWWGRASVDDKRVFVGLFVDKIVVTKSTTGRGQGTPI

                         EKRASITWAKPPTDDDEDDAQDGTEDVAA"

    ORIGIN

            1 atctacgtct gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca

           61 gctctcgcag ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt

          121 cctgcgggta aatagctgcg ccgatggttt ctacaaagat cgttatgttg atcggcactt

          181 tgcatcggcc gcgctcccga ttccggaagt gcttgacatt ggggaattta tgcggtgtga

          241 aataccgcac agatgcgtaa ggagaaaata ccgcatcagg cgccattcgc cattcaggct

          301 gcgcaactgt tgggaagggc gatcggtgcg ggcctcttcg ctattacgcc agctggcgaa

          361 agggggatgt gctgcaaggc gattaagttg ggtaacgcca gggttttccc agtcacgacg

          421 ttgtaaaacg acggccagtg ccaagcttgg gctgcaggtc gactctagag gatccgcggc

          481 cgcgcgcgat atcgaattcg taatcatgtc atagctgttt cctgtgtgaa attgttatcc

          541 gctcacaatt ccacacaaca tacgagccgg aagcataaag tgtaaagcct ggggtgccta

          601 atgagtgagc taactcacat taattgcgtt gcgctcactg cccgctttcc agtcgggaaa

          661 cctgtcgtgc cagctgcatt aatgaatcgg ccaacgcgcg gggagaggcg gtttgcgtat

          721 tgggcgctct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc ggctgcggcg

          781 agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag gggataacgc

          841 aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt

          901 gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc gacgctcaag

          961 tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc ctggaagctc

         1021 cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg cctttctccc

         1081 ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt cggtgtaggt

         1141 cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc gctgcgcctt

         1201 atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc cactggcagc

         1261 agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag agttcttgaa

         1321 gtggtggcct aactacggct acactagaag aacagtattt ggtatctgcg ctctgctgaa

         1381 gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg

         1441 tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga

         1501 agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact cacgttaagg

         1561 gattttggtc atgagattat caaaaaggat cttcacctag atccttttgg ttcatgtgca

         1621 gctccatcag caaaagggga tgataagttt atcaccaccg actatttgca acagtgccgt

         1681 tgatcgtgct atgatcgact gatgtcatca gcggtggagt gcaatgtcgt gcaatacgaa

         1741 tggcgaaaag ccgagctcat cggtcagctt ctcaaccttg gggttacccc cggcggtgtg

         1801 ctgctggtcc acagctcctt ccgtagcgtc cggcccctcg aagatgggcc acttggactg

         1861 atcgaggccc tgcgtgctgc gctgggtccg ggagggacgc tcgtcatgcc ctcgtggtca

         1921 ggtctggacg acgagccgtt cgatcctgcc acgtcgcccg ttacaccgga ccttggagtt

         1981 gtctctgaca cattctggcg cctgccaaat gtaaagcgca gcgcccatcc atttgccttt

         2041 gcggcagcgg ggccacaggc agagcagatc atctctgatc cattgcccct gccacctcac

         2101 tcgcctgcaa gcccggtcgc ccgtgtccat gaactcgatg ggcaggtact tctcctcggc

         2161 gtgggacacg atgccaacac gacgctgcat cttgccgagt tgatggcaaa ggttccctat

         2221 ggggtgccga gacactgcac cattcttcag gatggcaagt tggtacgcgt cgattatctc

         2281 gagaatgacc actgctgtga gcgctttgcc ttggcggaca ggtggctcaa ggagaagagc

         2341 cttcagaagg aaggtccagt cggtcatgcc tttgctcggt tgatccgctc ccgcgacatt

         2401 gtggcgacag ccctgggtca actgggccga gatccgttga tcttcctgca tccgccagag

         2461 gcgggatgcg aagaatgcga tgccgctcgc cagtcgattg gctgagctca tgagcggaga

         2521 acgagatgac gttggagggg caaggtcgcg ctgattgctg gggcaacacg tggagcggat

         2581 cggggattgt ctttcttcag ctcgctgatg atatgctgac gctcaatgcc gtttggcctc

         2641 cgactaacga aaatcccgca tttggacggc tgatccgatt ggcacggcgg acggcgaatg

         2701 gcggagcaga cgctcgtccg ggggcaatga gatatgaaaa agcctgaact caccgcgacg

         2761 tatcgggccc tggccagcta gctagagtcg acctgcaggt ccccggggat cggtcttgcc

         2821 ttgctcgtcg gtgatgtact tcaccagctc cgcgaagtcg ctcttcttga tggagcgcat

         2881 ggggacgtgc ttggcaatca cgcgcacccc ccggccgttt tagcggctaa aaaagtcatg

         2941 gctctgccct cgggcggacc acgcccatca tgaccttgcc aagctcgtcc tgcttctctt

         3001 cgatcttcgc cagcagggcg aggatcgtgg catcaccgaa ccgcgccgtg cgcgggtcgt

         3061 cggtgagcca gagtttcagc aggccgccca ggcggcccag gtcgccattg atgcgggcca

         3121 gctcgcggac gtgctcatag tccacgacgc ccgtgatttt gtagccctgg ccgacggcca

         3181 gcaggtaggc cgacaggctc atgccggccg ccgccgcctt ttcctcaatc gctcttcgtt

         3241 cgtctggaag gcagtacacc ttgataggtg ggctgccctt cctggttggc ttggtttcat

         3301 cagccatccg cttgccctca tctgttacgc cggcggtagc cggccagcct cgcagagcag

         3361 gattcccgtt gagcaccgcc aggtgcgaat aagggacagt gaagaaggaa cacccgctcg

         3421 cgggtgggcc tacttcacct atcctgcccg gctgacgccg ttggatacac caaggaaagt

         3481 ctacacgaac cctttggcaa aatcctgtat atcgtgcgaa aaaggatgga tataccgaaa

         3541 aaatcgctat aatgaccccg aagcagggtt atgcagcgga aaagatccgt cgacctgcag

         3601 gcatgcaagc tctagcgatt ccagacgtcc cgaaggcgtg gcgcggcttc cccgtgccgg

         3661 agcaatcgcc ctgggtgggt tacacgacgc ccctctatgg cccgtactga cggacacacc

         3721 gaagccccgg cggcaaccct cagcggatgc cccggggctt cacgttttcc caggtcagaa

         3781 gcggttttcg ggagtagtgc cccaactggg gtaacctttg agttctctca gttgggggcg

         3841 tagggtcgcc gacatgacac aaggggttgt gaccggggtg gacacgtacg cgggtgctta

         3901 cgaccgtcag tcgcgcgagc gcgagaattc gagcgcagca agcccagcga cacagcgtag

         3961 cgccaacgaa gacaaggcgg ccgaccttca gcgcgaagtc gagcgcgacg ggggccggtt

         4021 caggttcgtc gggcatttca gcgaagcgcc gggcacgtcg gcgttcggga cggcggagcg

         4081 cccggagttc gaacgcatcc tgaacgaatg ccgcgccggg cggctcaaca tgatcattgt

         4141 ctatgacgtg tcgcgcttct cgcgcctgaa ggtcatggac gcgattccga ttgtctcgga

         4201 attgctcgcc ctgggcgtga cgattgtttc cactcaggaa ggcgtcttcc ggcagggaaa

         4261 cgtcatggac ctgattcacc tgattatgcg gctcgacgcg tcgcacaaag aatcttcgct

         4321 gaagtcggcg aagattctcg acacgaagaa ccttcagcgc gaattgggcg ggtacgtcgg

         4381 cgggaaggcg ccttacggct tcgagcttgt ttcggagacg aaggagatca cgcgcaacgg

         4441 ccgaatggtc aatgtcgtca tcaacaagct tgcgcactcg accactcccc ttaccggacc

         4501 cttcgagttc gagcccgacg taatccggtg gtggtggcgt gagatcaaga cgcacaaaca

         4561 ccttcccttc aagccgggca gtcaagccgc cattcacccg ggcagcatca cggggctttg

         4621 taagcgcatg gacgctgacg ccgtgccgac ccggggcgag acgattggga agaagaccgc

         4681 ttcaagcgcc tgggacccgg caaccgttat gcgaatcctt cgggacccgc gtattgcggg

         4741 cttcgccgct gaggtgatct acaagaagaa gccggacggc acgccgacca cgaagattga

         4801 gggttaccgc attcagcgcg acccgatcac gctccggccg gtcgagcttg attgcggacc

         4861 gatcatcgag cccgctgagt ggtatgagct tcaggcgtgg ttggacggca gggggcgcgg

         4921 caaggggctt tcccgggggc aagccattct gtccgccatg gacaagctgt actgcgagtg

         4981 tggcgccgtc atgacttcga agcgcgggga agaatcgatc aaggactctt accgctgccg

         5041 tcgccggaag gtggtcgacc cgtccgcacc tgggcagcac gaaggcacgt gcaacgtcag

         5101 catggcggca ctcgacaagt tcgttgcgga acgcatcttc aacaagatca ggcacgccga

         5161 aggcgacgaa gagacgttgg cgcttctgtg ggaagccgcc cgacgcttcg gcaagctcac

         5221 tgaggcgcct gagaagagcg gcgaacgggc gaaccttgtt gcggagcgcg ccgacgccct

         5281 gaacgccctt gaagagctgt acgaagaccg cgcggcaggc gcgtacgacg gacccgttgg

         5341 caggaagcac ttccggaagc aacaggcagc gctgacgctc cggcagcaag gggcggaaga

         5401 gcggcttgcc gaacttgaag ccgccgaagc cccgaagctt ccccttgacc aatggttccc

         5461 cgaagacgcc gacgctgacc cgaccggccc taagtcgtgg tgggggcgcg cgtcagtaga

         5521 cgacaagcgc gtgttcgtcg ggctcttcgt agacaagatc gttgtcacga agtcgactac

         5581 gggcaggggg cagggaacgc ccatcgagaa gcgcgcttcg atcacgtggg cgaagccgcc

         5641 gaccgacgac gacgaagacg acgcccagga cggcacggaa gacgtagcgg cgtagcgaga

         5701 cacccgggaa gcctg

    //

     

    Caution:
    1.  This product is FOR RESEARCH USE ONLY!
    2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.