pBBR1MCS-1, 2 ug

https://www.gentaur.be/web/image/product.template/2011/image_1920?unique=b076c90
(0 review)

828,10 лв 828.1 BGN 828,10 лв VAT Excluded

422,50 € VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    pBBR1MCS-1

    PVT5601       2ug
     

     

    pBBR1MCS-1 Information

    Promoter: Lac/lac, T3, T7, or clone promoter 

    Replicator: pBBR1 Rep, pBBR1 oriV

    Plasmid classification: pBBR1MCS series plasmids

    Plasmid size: 4707bp

    Plasmid label: LacZ

    Prokaryotic resistance: chloramphenicol Chloramphenicol

    Cloned strain: DH5 alpha

    Culture conditions: 37 centigrade, aerobic, LB

    Host: a wide host

    Culture conditions: Reference Literature

    5'sequencing primers: M13R:CAGGAAACAGCTATGACC

    3'sequencing primers: M13F:TGTAAAACGACGGCCAGT

    Remarks: low copy plasmids

    A brief introduction of plasmids

    Use:pBBR1MCS Series plasmid

     

    pBBR1MCS-1 Description

    Broad host shuttle plasmid pBBR1MCS-1 is constructed by Kovach, has confirmed that [2] can replicate in many Gram-negative bacteria, including Acetobacter xylinum, Alcaligenes eutrophus, Bartonella, bacilliformis (Bordetella spp.), pertussis (Brucella spp.), Caulobacter of Brucella crescentus, Escherichia coli, Pseudomonas fluorescens, Paracoccous denitrificans (Pseudomonas fluorescens) Pseudomonas putida (P., putida), alfalfa Rhizobium (Rhizobium meliloti), R. leguminosarum by. Viciae, rhodobactersphaeroides (Rhodobacter sphaeroides), Salmonella typhimurium (Salmonella, typhimurium) of Vibrio cholerae (Vibrio cholerae) and Xanthomonas campestris.

    [1] Kovach ME, et al. pBBR1MCS: a broad-host-range cloning vector. Biotechniques, 1994,16 (5):

    [2] Kovach ME, Elzer PH, Hill DS, et al. Four new, al., and PH.

     

    pBBR1MCS-1 Sequence

    LOCUS       Exported                4707 bp ds-DNA     circular SYN 04-SEP-2016

    DEFINITION  synthetic circular DNA

    ACCESSION   .

    VERSION     .

    KEYWORDS    pBBR1MCS-1

    SOURCE      synthetic DNA construct

      ORGANISM  synthetic DNA construct

    REFERENCE   1  (bases 1 to 4707)

      AUTHORS   .

      TITLE     Direct Submission

      JOURNAL   Exported Sunday, September 4, 2016 from SnapGene Viewer 3.1.4

    FEATURES             Location/Qualifiers

         source          1..4707

                         /organism="synthetic DNA construct"

                         /mol_type="other DNA"

         rep_origin      1023..1792

                         /note="pBBR1 oriV"

                         /note="replication origin of the broad-host-range plasmid 

                         pBBR1 from Bordetella bronchiseptica; requires the pBBR1 

                         Rep protein for replication"

         CDS             1793..2455

                         /codon_start=1

                         /product="replication protein for the broad-host-range 

                         plasmid pBBR1 from Bordetella bronchiseptica"

                         /note="pBBR1 Rep"

                         /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH

                         HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV

                         NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE

                         PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"

         CDS             complement(3013..3378)

                         /codon_start=1

                         /gene="lacZ fragment"

                         /product="LacZ-alpha fragment of beta-galactosidase"

                         /note="lacZ-alpha"

                         /translation="MTMITPSAQLTLTKGNKSWVPGPPSRSTVSISLISNSCSPGDPLV

                         LERPPPRWSSNSPYSESYYARSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR

                         TDRPSQQLRSLNGEWKL"

         primer_bind     3162..3178

                         /note="M13 fwd"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         promoter        3188..3206

                         /note="T7 promoter"

                         /note="promoter for bacteriophage T7 RNA polymerase"

         misc_feature    3215..3322

                         /note="MCS"

                         /note="pBluescript multiple cloning site"

         primer_bind     3239..3255

                         /note="SK primer"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         primer_bind     complement(3289..3305)

                         /note="KS primer"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         promoter        complement(3335..3353)

                         /note="T3 promoter"

                         /note="promoter for bacteriophage T3 RNA polymerase"

         primer_bind     complement(3374..3390)

                         /note="M13 rev"

                         /note="common sequencing primer, one of multiple similar 

                         variants"

         protein_bind    3398..3414

                         /bound_moiety="lac repressor encoded by lacI"

                         /note="lac operator"

                         /note="The lac repressor binds to the lac operator to 

                         inhibit transcription in E. coli. This inhibition can be 

                         relieved by adding lactose or 

                         isopropyl-beta-D-thiogalactopyranoside (IPTG)."

         promoter        complement(3422..3452)

                         /note="lac promoter"

                         /note="promoter for the E. coli lac operon"

         protein_bind    3467..3488

                         /bound_moiety="E. coli catabolite activator protein"

                         /note="CAP binding site"

                         /note="CAP binding activates transcription in the presence 

                         of cAMP."

         CDS             complement(3545..4234)

                         /codon_start=1

                         /note="Chl"

                         /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                         KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                         LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                         DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQFLCMRPIRKPPL

                         PARWPIH"

         promoter        complement(4235..4337)

                         /note="cat promoter"

                         /note="promoter of the E. coli cat gene encoding 

                         chloramphenicol acetyltransferase"

    ORIGIN

            1 ctcgggccgt ctcttgggct tgatcggcct tcttgcgcat ctcacgcgct cctgcggcgg

           61 cctgtagggc aggctcatac ccctgccgaa ccgcttttgt cagccggtcg gccacggctt

          121 ccggcgtctc aacgcgcttt gagattccca gcttttcggc caatccctgc ggtgcatagg

          181 cgcgtggctc gaccgcttgc gggctgatgg tgacgtggcc cactggtggc cgctccaggg

          241 cctcgtagaa cgcctgaatg cgcgtgtgac gtgccttgct gccctcgatg ccccgttgca

          301 gccctagatc ggccacagcg gccgcaaacg tggtctggtc gcgggtcatc tgcgctttgt

          361 tgccgatgaa ctccttggcc gacagcctgc cgtcctgcgt cagcggcacc acgaacgcgg

          421 tcatgtgcgg gctggtttcg tcacggtgga tgctggccgt cacgatgcga tccgccccgt

          481 acttgtccgc cagccacttg tgcgccttct cgaagaacgc cgcctgctgt tcttggctgg

          541 ccgacttcca ccattccggg ctggccgtca tgacgtactc gaccgccaac acagcgtcct

          601 tgcgccgctt ctctggcagc aactcgcgca gtcggcccat cgcttcatcg gtgctgctgg

          661 ccgcccagtg ctcgttctct ggcgtcctgc tggcgtcagc gttgggcgtc tcgcgctcgc

          721 ggtaggcgtg cttgagactg gccgccacgt tgcccatttt cgccagcttc ttgcatcgca

          781 tgatcgcgta tgccgccatg cctgcccctc ccttttggtg tccaaccggc tcgacggggg

          841 cagcgcaagg cggtgcctcc ggcgggccac tcaatgcttg agtatactca ctagactttg

          901 cttcgcaaag tcgtgaccgc ctacggcggc tgcggcgccc tacgggcttg ctctccgggc

          961 ttcgccctgc gcggtcgctg cgctcccttg ccagcccgtg gatatgtgga cgatggccgc

         1021 gagcggccac cggctggctc gcttcgctcg gcccgtggac aaccctgctg gacaagctga

         1081 tggacaggct gcgcctgccc acgagcttga ccacagggat tgcccaccgg ctacccagcc

         1141 ttcgaccaca tacccaccgg ctccaactgc gcggcctgcg gccttgcccc atcaattttt

         1201 ttaattttct ctggggaaaa gcctccggcc tgcggcctgc gcgcttcgct tgccggttgg

         1261 acaccaagtg gaaggcgggt caaggctcgc gcagcgaccg cgcagcggct tggccttgac

         1321 gcgcctggaa cgacccaagc ctatgcgagt gggggcagtc gaaggcgaag cccgcccgcc

         1381 tgccccccga gcctcacggc ggcgagtgcg ggggttccaa gggggcagcg ccaccttggg

         1441 caaggccgaa ggccgcgcag tcgatcaaca agccccggag gggccacttt ttgccggagg

         1501 gggagccgcg ccgaaggcgt gggggaaccc cgcaggggtg cccttctttg ggcaccaaag

         1561 aactagatat agggcgaaat gcgaaagact taaaaatcaa caacttaaaa aaggggggta

         1621 cgcaacagct cattgcggca ccccccgcaa tagctcattg cgtaggttaa agaaaatctg

         1681 taattgactg ccacttttac gcaacgcata attgttgtcg cgctgccgaa aagttgcagc

         1741 tgattgcgca tggtgccgca accgtgcggc accctaccgc atggagataa gcatggccac

         1801 gcagtccaga gaaatcggca ttcaagccaa gaacaagccc ggtcactggg tgcaaacgga

         1861 acgcaaagcg catgaggcgt gggccgggct tattgcgagg aaacccacgg cggcaatgct

         1921 gctgcatcac ctcgtggcgc agatgggcca ccagaacgcc gtggtggtca gccagaagac

         1981 actttccaag ctcatcggac gttctttgcg gacggtccaa tacgcagtca aggacttggt

         2041 ggccgagcgc tggatctccg tcgtgaagct caacggcccc ggcaccgtgt cggcctacgt

         2101 ggtcaatgac cgcgtggcgt ggggccagcc ccgcgaccag ttgcgcctgt cggtgttcag

         2161 tgccgccgtg gtggttgatc acgacgacca ggacgaatcg ctgttggggc atggcgacct

         2221 gcgccgcatc ccgaccctgt atccgggcga gcagcaacta ccgaccggcc ccggcgagga

         2281 gccgcccagc cagcccggca ttccgggcat ggaaccagac ctgccagcct tgaccgaaac

         2341 ggaggaatgg gaacggcgcg ggcagcagcg cctgccgatg cccgatgagc cgtgttttct

         2401 ggacgatggc gagccgttgg agccgccgac acgggtcacg ctgccgcgcc ggtagcactt

         2461 gggttgcgca gcaacccgta agtgcgctgt tccagactat cggctgtagc cgcctcgccg

         2521 ccctatacct tgtctgcctc cccgcgttgc gtcgcggtgc atggagccgg gccacctcga

         2581 cctgaatgga agccggcggc acctcgctaa cggattcacc gtttttatca ggctctggga

         2641 ggcagaataa atgatcatat cgtcaattat tacctccacg gggagagcct gagcaaactg

         2701 gcctcaggca tttgagaagc acacggtcac actgcttccg gtagtcaata aaccggtaaa

         2761 ccagcaatag acataagcgg ctatttaacg accctgccct gaaccgacga ccgggtcgaa

         2821 tttgctttcg aatttctgcc attcatccgc ttattatcac ttattcaggc gtagcaccag

         2881 gcgtttaagg gcaccaataa ctgccttaaa aaaattacgc cccgccctgc cactcatcgc

         2941 agtcggccta ttggttaaaa aatgagctga tttaacaaaa atttaacgcg aattttaaca

         3001 aaatattaac gcttacaatt tccattcgcc attcaggctg cgcaactgtt gggaagggcg

         3061 atcggtgcgg gcctcttcgc tattacgcca gctggcgaaa gggggatgtg ctgcaaggcg

         3121 attaagttgg gtaacgccag ggttttccca gtcacgacgt tgtaaaacga cggccagtga

         3181 gcgcgcgtaa tacgactcac tatagggcga attggagctc caccgcggtg gcggccgctc

         3241 tagaactagt ggatcccccg ggctgcagga attcgatatc aagcttatcg ataccgtcga

         3301 cctcgagggg gggcccggta cccagctttt gttcccttta gtgagggtta attgcgcgct

         3361 tggcgtaatc atggtcatag ctgtttcctg tgtgaaattg ttatccgctc acaattccac

         3421 acaacatacg agccggaagc ataaagtgta aagcctgggg tgcctaatga gtgagctaac

         3481 tcacattaat tgcgttgcgc tcactgcccg ctttccagtc gggaaacctg tcgtgccagc

         3541 tgcattaatg aatcggccaa cgcgcgggga gaggcggttt gcgtattggg cgcatgcata

         3601 aaaactgttg taattcatta agcattctgc cgacatggaa gccatcacaa acggcatgat

         3661 gaacctgaat cgccagcggc atcagcacct tgtcgccttg cgtataatat ttgcccatgg

         3721 tgaaaacggg ggcgaagaag ttgtccatat tggccacgtt taaatcaaaa ctggtgaaac

         3781 tcacccaggg attggctgag acgaaaaaca tattctcaat aaacccttta gggaaatagg

         3841 ccaggttttc accgtaacac gccacatctt gcgaatatat gtgtagaaac tgccggaaat

         3901 cgtcgtggta ttcactccag agcgatgaaa acgtttcagt ttgctcatgg aaaacggtgt

         3961 aacaagggtg aacactatcc catatcacca gctcaccgtc tttcattgcc atacggaatt

         4021 ccggatgagc attcatcagg cgggcaagaa tgtgaataaa ggccggataa aacttgtgct

         4081 tatttttctt tacggtcttt aaaaaggccg taatatccag ctgaacggtc tggttatagg

         4141 tacattgagc aactgactga aatgcctcaa aatgttcttt acgatgccat tgggatatat

         4201 caacggtggt atatccagtg atttttttct ccattttagc ttccttagct cctgaaaatc

         4261 tcgataactc aaaaaatacg cccggtagtg atcttatttc attatggtga aagttggaac

         4321 ctcttacgtg ccgatcaacg tctcattttc gccaaaagtt ggcccagggc ttcccggtat

         4381 caacagggac accaggattt atttattctg cgaagtgatc ttccgtcaca ggtatttatt

         4441 cgaagacgaa agggcctcgt gatacgccta tttttatagg ttaatgtcat gataataatg

         4501 gtttcttaga cgtcaggtgg cacttttcgg ggaaatgtgc gcgcccgcgt tcctgctggc

         4561 gctgggcctg tttctggcgc tggacttccc gctgttccgt cagcagcttt tcgcccacgg

         4621 ccttgatgat cgcggcggcc ttggcctgca tatcccgatt caacggcccc agggcgtcca

         4681 gaacgggctt caggcgctcc cgaaggt

    //

    Caution:
    Product is for research use only!

     

    Search name

    pBBR1MCS-1,Plasmid pBBR1MCS-1,pBBR1MCS-1 vector